Buy Deus Medical PNC-27 10mg Online: Product Description
When you buy Deus Medical PNC-27 10mg Online from us, you receive a premium research peptide produced to consistent quality standards. PNC-27 is a synthetic 32 amino acid peptide that has drawn significant attention in laboratory research over the past two decades. It combines residues 12 to 26 of the human p53 protein, the region that binds HDM2, with a penetratin sequence that helps the molecule anchor into cell membranes.
Researchers study PNC-27 because of a specific finding: in cell culture and animal models, it appeared to bind HDM2 proteins found on the membranes of certain abnormal cells, while showing little effect on normal cells in the same studies. This selective membrane interaction makes it a valuable compound for scientists investigating peptide and membrane biology.
Deus Medical supplies PNC-27 as a lyophilized powder in a sealed 10mg vial, ready for reconstitution in a laboratory setting.
Key Features of Deus Medical PNC-27 10mg
- 10mg per vial, accurately measured for consistent research results
- Lyophilized powder for improved stability during storage and shipping
- Trusted Deus Medical brand known across the research compound market
- Sealed, sterile vial to protect sample integrity
- Discreet packaging on every order
Ingredients in Deus Medical PNC-27 10mg
The single active component is PNC-27 peptide, sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG, with an approximate molecular weight of 4,031 Da. The first fifteen residues come from the p53 HDM2 binding domain, and the remaining residues form the penetratin membrane residency sequence. The vial contains no fillers beyond what is required for lyophilization.
Research Benefits When You Buy Deus Medical PNC-27 10mg Online
Published laboratory studies describe PNC-27 as a useful tool for exploring how peptides interact with membrane bound proteins. Reported research findings include selective binding to HDM2 expressed on certain cell membranes, formation of transmembrane pores in targeted cells in vitro, and minimal activity against normal control cells in the same experiments. These properties give researchers a model compound for studying membrane disruption, protein targeting and peptide design.
It is important to note that PNC-27 is not approved by the FDA or any other regulatory agency for treating, curing or preventing any disease, and no completed human clinical trials have established its safety or effectiveness.
Recommended Usage for Deus Medical PNC-27 10mg
This product is intended for qualified researchers in a controlled laboratory environment. Standard handling for lyophilized peptides applies. Store the unopened vial in a refrigerator at 2 to 8°C, or frozen for long term storage, away from light. Reconstitute with bacteriostatic or sterile water using aseptic technique, allowing the liquid to run gently down the vial wall rather than shaking. Once reconstituted, keep refrigerated and use within the timeframe your research protocol specifies.
Stacking Options With Deus Medical PNC-27 10mg
In published research, PNC-27 is most often studied alongside its sister compound PNC-28, a shorter variant that uses p53 residues 17 to 26. Laboratories frequently compare the two to examine how sequence length affects membrane binding. PNC-27 is not a performance or bodybuilding compound, and we do not recommend combining it with other products outside of a structured research design.
Safety and Precautions for Deus Medical PNC-27 10mg
PNC-27 is sold for research purposes only and is not for human or veterinary use. Handle it with gloves, eye protection and standard laboratory safety practices. Keep it out of reach of children and unauthorized persons. Anyone facing a medical condition, especially cancer, should work with a licensed oncologist rather than rely on unapproved research compounds.
Why Buy Deus Medical PNC-27 10mg Online From Us
Researchers choose us because we make ordering simple and reliable. Every order is packed discreetly and shipped quickly with tracking. We stock genuine Deus Medical products, store them correctly before dispatch, and back every purchase with responsive customer support. Secure checkout protects your details, and our team is always ready to answer questions about your order. When quality and consistency matter, buy Deus Medical PNC-27 10mg Online with confidence from a supplier that puts your research first.
Frequently Asked Questions About PNC-27
What is PNC-27?
PNC-27 is a synthetic peptide made from part of the p53 protein joined to a membrane penetrating sequence. Researchers study it for its selective interaction with HDM2 on cell membranes.
How does PNC-27 work in research studies?
Laboratory studies report that it binds HDM2 on certain cell membranes and forms pores that disrupt those cells, while normal control cells were largely unaffected in the same experiments.
Is PNC-27 FDA approved?
No. PNC-27 has no FDA approval for any medical use and has not completed human clinical trials.
Can PNC-27 cure cancer?
No evidence shows that PNC-27 cures or treats cancer in humans. Findings so far come from cell culture and animal research only.
What is the difference between PNC-27 and PNC-28?
Both contain the penetratin sequence, but PNC-27 includes p53 residues 12 to 26 while PNC-28 uses the shorter residues 17 to 26.
How should I store PNC-27 10mg?
Keep the lyophilized vial refrigerated or frozen and away from light. After reconstitution, keep it refrigerated.
How long does shipping take?
Most orders dispatch quickly with tracking and discreet packaging. Delivery times depend on your location.
Reviews
There are no reviews yet.